General Information

  • ID:  hor005521
  • Uniprot ID:  P55848
  • Protein name:  Molt-inhibiting hormone
  • Gene name:  NA
  • Organism:  Procambarus clarkii (Red swamp crayfish)
  • Family:  arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Procambarus (genus), Cambarinae (subfamily), Cambaridae (family), Astacoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RYVFEECPGVMGNRAVHGKVTRVCEDCYNVFRDTDVLAGCRKGCFSSEMFKLCLLAMERVEEFPDFKRWIGILNA
  • Length:  75(1-75)
  • Propeptide:  RYVFEECPGVMGNRAVHGKVTRVCEDCYNVFRDTDVLAGCRKGCFSSEMFKLCLLAMERVEEFPDFKRWIGILNA
  • Signal peptide:  NA
  • Modification:  T75 Alanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops. Has little or no hyperglycemic activity.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  7-44; 24-40; 27-53
  • Structure ID:  AF-P55848-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P55848-F1.pdbhor005521_AF2.pdbhor005521_ESM.pdb

Physical Information

Mass: 997819 Formula: C381H592N106O107S9
Absent amino acids: Q Common amino acids: VER
pI: 7.05 Basic residues: 12
Polar residues: 21 Hydrophobic residues: 26
Hydrophobicity: -6.8 Boman Index: -13141
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 72.67
Instability Index: 3604.4 Extinction Coefficient cystines: 8855
Absorbance 280nm: 119.66

Literature

  • PubMed ID:  8901124
  • Title:  Isolation and amino acid sequence of a molt-inhibiting hormone from the American crayfish, Procambarus clarkii.